PDB entry 1sen

View 1sen on RCSB PDB site
Description: Endoplasmic reticulum protein Rp19 O95881
Class: structural genomics, unknown function
Keywords: Endoplasmic reticulum, Rp19, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, UNKNOWN FUNCTION
Deposited on 2004-02-17, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-like protein p19
    Species: Homo sapiens [TaxId:9606]
    Gene: TLP19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sena_
  • Heterogens: PT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1senA (A:)
mggshhhhhhgmasssdghnglgkgfgdhihwrtledgkkeaaasglplmviihkswcga
ckalkpkfaesteiselshnfvmvnledeeepkdedfspdggyiprilfldpsgkvhpei
inengnpsykyfyvsaeqvvqgmkeaqerltgdafrkkhledel

    Sequence, based on observed residues (ATOM records): (download) 
    >1senA (A:)
lgkgfgdhihwrtledgkkeaaasglplmviihkswcgackalkpkfaesteiselshnf
vmvnledeeepkdedfspdggyiprilfldpsgkvhpeiinengnpsykyfyvsaeqvvq
gmkeaqerltgdafr