PDB entry 1sem

View 1sem on RCSB PDB site
Description: structural determinants of peptide-binding orientation and of sequence specificity in sh3 domains
Class: signal transduction protein
Keywords: src-homology 3 (sh3) domain, peptide-binding protein, guanine nucleotide exchange factor, signal transduction protein
Deposited on 1995-03-28, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sem-5
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sema_
  • Chain 'B':
    Compound: sem-5
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1semb_
  • Chain 'C':
    Compound: 10-residue proline-rich peptide from msos (ace-pro-pro-pro-val-pro-pro-arg-arg-arg)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SEM
  • Chain 'D':
    Compound: 10-residue proline-rich peptide from msos (ace-pro-pro-pro-val-pro-pro-arg-arg-arg)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SEM
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1semA (A:)
etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1semB (B:)
etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn

    Sequence, based on observed residues (ATOM records): (download) 
    >1semB (B:)
tkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.