PDB entry 1sek

View 1sek on RCSB PDB site
Description: the structure of active serpin k from manduca sexta and a model for serpin-protease complex formation
Class: serine protease inhibitor
Keywords: serine protease inhibitor, serpin, protease
Deposited on 1998-03-06, released 1999-03-23
The last revision prior to the SCOP 1.73 freeze date was dated 1999-03-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serpin k
    Species: Manduca sexta
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14754 (Start-377)
      • conflict (180)
      • conflict (340)
      • conflict (342-344)
      • conflict (346-349)
      • conflict (351)
      • conflict (353)
      • conflict (355-356)
      • conflict (359)
      • conflict (361)
      • conflict (364-368)
      • conflict (371)
      • conflict (373-376)
    Domains in SCOP 1.73: d1seka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sekA (A:)
    magetdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshde
    llralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgs
    evqnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkf
    nkertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnq
    vdgitaleqklkdpkalsraeerlynteveiylpkfkietttdlkevlsnmnikklftpg
    aarlenllktkeslyvdaaiqkafievneegaeaaaanafkittysfhfvpkveinkpff
    fslkynrnsmfsgvcvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sekA (A:)
    getdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshdell
    ralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgsev
    qnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkfnk
    ertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnqvd
    gitaleqklkdpkalsraeerlynteveiylpkfkietttdlkevlsnmnikklftpgaa
    rlenllktkeslyvdaaiqkafievneegaeaaaanafkittysfhfvpkveinkpfffs
    lkynrnsmfsgvcvqp