PDB entry 1sek

View 1sek on RCSB PDB site
Description: the structure of active serpin k from manduca sexta and a model for serpin-protease complex formation
Deposited on 1998-03-06, released 1999-03-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1sek__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sek_ (-)
    getdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshdell
    ralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgsev
    qnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkfnk
    ertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnqvd
    gitaleqklkdpkalsraeerlynteveiylpkfkietttdlkevlsnmnikklftpgaa
    rlenllktkeslyvdaaiqkafievneegaeaaaanafkittysfhfvpkveinkpfffs
    lkynrnsmfsgvcvqp