PDB entry 1sej

View 1sej on RCSB PDB site
Description: Crystal Structure of Dihydrofolate Reductase-Thymidylate Synthase from Cryptosporidium hominis Bound to 1843U89/NADPH/dUMP
Class: transferase, oxidoreductase
Keywords: bifunctional enzyme, TRANSFERASE, OXIDOREDUCTASE
Deposited on 2004-02-17, released 2004-05-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.22
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1seja1, d1seja2
  • Chain 'B':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1sejb1, d1sejb2
  • Chain 'C':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1sejc1, d1sejc2
  • Chain 'D':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1sejd1, d1sejd2
  • Chain 'E':
    Compound: Bifunctional dihydrofolate reductase-thymidylate synthase
    Species: Cryptosporidium hominis [TaxId:237895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1seje1, d1seje2
  • Heterogens: UMP, F89, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sejA (A:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sejA (A:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sejB (B:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sejB (B:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sejC (C:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sejC (C:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sejD (D:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sejD (D:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sejE (E:)
    mseknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwd
    sigrrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyr
    dalkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
    ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
    ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
    gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
    tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
    yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
    prpfpqlkfkrkveniedfkwedieligyypyptikmdmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sejE (E:)
    eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
    grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
    lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqekkt
    lqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyld
    llsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgd
    tngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytg
    vgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyq
    rscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtpr
    pfpqlkfkrkveniedfkwedieligyypyptikmdmav