PDB entry 1sei

View 1sei on RCSB PDB site
Description: structure of 30s ribosomal protein s8
Class: ribosomal protein
Keywords: prokaryotic, ribosomal protein, rRNA-binding
Deposited on 1996-08-14, released 1997-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.222
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s8
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: BACILLUS STEAROTHERMOPHILUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1seia_
  • Chain 'B':
    Compound: ribosomal protein s8
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: BACILLUS STEAROTHERMOPHILUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1seib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1seiA (A:)
    vmtdpiadmltairnanmvrheklevpaskikreiaeilkregfirdyeyiednkqgilr
    iflkygpnervitglkriskpglrvyvkahevprvlnglgiailstsqgvltdkearqkg
    tggeiiayvi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1seiB (B:)
    vmtdpiadmltairnanmvrheklevpaskikreiaeilkregfirdyeyiednkqgilr
    iflkygpnervitglkriskpglrvyvkahevprvlnglgiailstsqgvltdkearqkg
    tggeiiayvi