PDB entry 1sef

View 1sef on RCSB PDB site
Description: Crystal structure of cupin domain protein EF2996 from Enterococcus faecalis
Class: structural genomics, unknown function
Keywords: Structural genomics, NYSGXRC target T1582, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, unknown function
Deposited on 2004-02-17, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.208
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sefa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sefA (A:)
    mslmgyknnrvgyqkelltsravikkdnyaiiphdglvqnavpgfenvdisilgspklga
    tfvdyiatfhkngqqttgfggdgiqtlvyvidgrlrvsdgqetheleaggyayftpemkm
    ylanaqeadtevflykkryqplaghqpykvvgsihdqqpeeyegmtdvllwsllpkefdf
    dmnmhilsfepgashayiethvqehgaylisgqgmynldnewypvekgdyifmsayvpqa
    ayavgreeplmyvyskdanrepeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sefA (A:)
    kelltsravikkdnyaiiphdglvqnavpgfenvdisilgspklgatfvdyiatfhkngq
    qttgfggdgiqtlvyvidgrlrvsdgqetheleaggyayftpemkmylanaqeadtevfl
    ykkryqplaghqpykvvgsihdqqpeeyegmtdvllwsllpkefdfdmnmhilsfepgas
    hayiethvqehgaylisgqgmynldnewypvekgdyifmsayvpqaayavgreeplmyvy
    skdanrepel