PDB entry 1sed

View 1sed on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function YhaL from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: Structural Genomics, Hypothetical Protein, YhaI, Four Helix bundle, colied-coil, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-02-17, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yhaI
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YhaI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1seda_
  • Chain 'B':
    Compound: Hypothetical protein yhaI
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YhaI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sedb_
  • Chain 'C':
    Compound: Hypothetical protein yhaI
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YhaI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sedc_
  • Heterogens: ZN, NA, MPD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sedA (A:)
    ghmdsmdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseela
    tqkaqgfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfdgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sedA (A:)
    dsmdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseelatqk
    aqgfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sedB (B:)
    ghmdsmdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseela
    tqkaqgfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfdgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sedB (B:)
    mdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseelatqkaq
    gfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sedC (C:)
    ghmdsmdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseela
    tqkaqgfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfdgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sedC (C:)
    dsmdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseelatqk
    aqgfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfd