PDB entry 1se9

View 1se9 on RCSB PDB site
Description: Structure of At3g01050, a ubiquitin-fold protein from Arabidopsis thaliana
Class: plant protein
Keywords: ubiquitin-like, cell-free, wheat germ, Structural genomics, Protein structure Initiative, CESG, PSI, Center for Eukaryotic Structural Genomics, PLANT PROTEIN
Deposited on 2004-02-16, released 2004-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin family
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: At3g01050
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9MAB9 (10-End)
    • insertion (9)
  Domains in SCOPe 2.06: d1se9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1se9A (A:)
  mghhhhhhleaevhnqleikfrltdgsdigpkafpdattvsalketvisewprekengpk
  tvkevklisagkvlensktvkdyrspvsnlagavttmhviiqapvtekekkpkgdpkmnk
  cvcsvm
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1se9A (A:)
  eaevhnqleikfrltdgsdigpkafpdattvsalketvisewprekengpktvkevklis
  agkvlensktvkdyrspvsnlagavttmhviiqapvtekek