PDB entry 1se8

View 1se8 on RCSB PDB site
Description: Structure of single-stranded DNA-binding protein (SSB) from D. radiodurans
Deposited on 2004-02-16, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1se8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1se8A (A:)
    margmnhvyligalardpelrytgngmavfeatvagedrvigndgrernlpwyhrvsilg
    kpaewqaernlkggdavvvegtleyrqweapeggkrsavnvkalrmeqlgtqpeliqdag
    ggvrmsgamnevlvlgnvtrdpeirytpagdavlslsiavnenyqdrqgqrqekvhyida
    tlwrdlaenmkelrkgdpvmimgrlvnegwtdkdgnkrnstrveatrvealargagnans
    gyaaatpaaprtqtassaarptsggyqsqpsraantgsrsggldidqglddfppeeddlp
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >1se8A (A:)
    rgmnhvyligalardpelrytgngmavfeatvagedrvrnlpwyhrvsilgkpaewqaer
    nlkggdavvvegtleyrqwekrsavnvkalrmeqlgtqpeliqdagggvrmsgamnevlv
    lgnvtrdpeirytpagdavlslsiavnenyqdrqgqrqekvhyidatlwrdlaenmkelr
    kgdpvmimgrlvnegwtrnstrveatrvealar