PDB entry 1se8

View 1se8 on RCSB PDB site
Description: Structure of single-stranded DNA-binding protein (SSB) from D. radiodurans
Class: DNA binding protein
Keywords: Single-strand binding protein, DNA BINDING PROTEIN
Deposited on 2004-02-16, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-strand binding protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: SSB, DR0099
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RY51
      • modified residue (4)
      • modified residue (26)
      • modified residue (105)
      • modified residue (124)
      • modified residue (128)
      • modified residue (189)
      • modified residue (199)
      • modified residue (201)
    Domains in SCOPe 2.08: d1se8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1se8A (A:)
    margmnhvyligalardpelrytgngmavfeatvagedrvigndgrernlpwyhrvsilg
    kpaewqaernlkggdavvvegtleyrqweapeggkrsavnvkalrmeqlgtqpeliqdag
    ggvrmsgamnevlvlgnvtrdpeirytpagdavlslsiavnenyqdrqgqrqekvhyida
    tlwrdlaenmkelrkgdpvmimgrlvnegwtdkdgnkrnstrveatrvealargagnans
    gyaaatpaaprtqtassaarptsggyqsqpsraantgsrsggldidqglddfppeeddlp
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >1se8A (A:)
    rgmnhvyligalardpelrytgngmavfeatvagedrvrnlpwyhrvsilgkpaewqaer
    nlkggdavvvegtleyrqwekrsavnvkalrmeqlgtqpeliqdagggvrmsgamnevlv
    lgnvtrdpeirytpagdavlslsiavnenyqdrqgqrqekvhyidatlwrdlaenmkelr
    kgdpvmimgrlvnegwtrnstrveatrvealar