PDB entry 1se6

View 1se6 on RCSB PDB site
Description: Crystal Structure of Streptomyces Coelicolor A3(2) CYP158A2 from antibiotic biosynthetic pathways
Class: oxidoreductase
Keywords: streptomyces, Cytochrome P450 oxidoreductase, CYP158A2, antibiotic biosynthesis, OXIDOREDUCTASE
Deposited on 2004-02-16, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome P450
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FCA6 (Start-403)
      • cloning artifact (404-405)
    Domains in SCOPe 2.07: d1se6a1, d1se6a2
  • Chain 'B':
    Compound: putative cytochrome P450
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FCA6 (Start-403)
      • cloning artifact (404-405)
    Domains in SCOPe 2.07: d1se6b1, d1se6b2
  • Heterogens: SPK, HEM, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1se6A (A:)
    mteetisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddv
    rlvtndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargverv
    rersrgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlils
    sshgaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllq
    iggeavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialed
    veikgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlar
    lesellvdavldrvpglklavapedvpfkkgalirgpealpvtwhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1se6A (A:)
    tisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvt
    ndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrers
    rgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtemnayfsdl
    iglrsdsagedvtsllgaavgrdeitlseavglavllqiggeavtnnsgqmfhlllsrpe
    laerlrsepeirpraidellrwiphrnavglsrialedveikgvriragdavyvsylaan
    rdpevfpdpdridferspnphvsfgfgphycpggmlarlesellvdavldrvpglklava
    pedvpfkkgalirgpealpvtwhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1se6B (B:)
    mteetisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddv
    rlvtndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargverv
    rersrgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlils
    sshgaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllq
    iggeavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialed
    veikgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlar
    lesellvdavldrvpglklavapedvpfkkgalirgpealpvtwhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1se6B (B:)
    tisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvt
    ndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrers
    rgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshg
    aevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigge
    avtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveik
    gvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarlese
    llvdavldrvpglklavapedvpfkkgalirgpealpvtwhh