PDB entry 1se0

View 1se0 on RCSB PDB site
Description: Crystal structure of DIAP1 BIR1 bound to a Grim peptide
Class: apoptosis
Keywords: apoptosis, IAP, BIR, Grim, caspase
Deposited on 2004-02-15, released 2004-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.212
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis 1 inhibitor
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: IAP1, TH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24306
      • conflict (59)
    Domains in SCOPe 2.08: d1se0a_
  • Chain 'B':
    Compound: cell death protein GRIM
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1SE0 (0-End)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1se0A (A:)
    knninktrmndlnreetrlktftdwpldwldkrqlaqtgmyfthagdkvkcffcgveigs
    weqedqpvpehqrwspncpllrrrttnnvpinaealdrilppisydicgandstle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1se0A (A:)
    ndlnreetrlktftdwpldwldkrqlaqtgmyfthagdkvkcffcgveigsweqedqpvp
    ehqrwspncpllrrrttnnvpinaealdrilppisyd
    

  • Chain 'B':
    No sequence available.