PDB entry 1se0
View 1se0 on RCSB PDB site
Description: Crystal structure of DIAP1 BIR1 bound to a Grim peptide
Class: apoptosis
Keywords: apoptosis, IAP, BIR, Grim, caspase
Deposited on
2004-02-15, released
2004-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.212
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: apoptosis 1 inhibitor
Species: Drosophila melanogaster [TaxId:7227]
Gene: IAP1, TH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1se0a_ - Chain 'B':
Compound: cell death protein GRIM
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1se0A (A:)
knninktrmndlnreetrlktftdwpldwldkrqlaqtgmyfthagdkvkcffcgveigs
weqedqpvpehqrwspncpllrrrttnnvpinaealdrilppisydicgandstle
Sequence, based on observed residues (ATOM records): (download)
>1se0A (A:)
ndlnreetrlktftdwpldwldkrqlaqtgmyfthagdkvkcffcgveigsweqedqpvp
ehqrwspncpllrrrttnnvpinaealdrilppisyd
- Chain 'B':
No sequence available.