PDB entry 1sdz

View 1sdz on RCSB PDB site
Description: Crystal structure of DIAP1 BIR1 bound to a Reaper peptide
Deposited on 2004-02-15, released 2004-04-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.232
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1sdza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1sdzA (A:)
knninktrmndlnreetrlktftdwpldwldkrqlaqtgmyfthagdkvkcffcgveigs
weqedqpvpehqrwspncpllrrrttnnvpinaealdrilppisydicgandstle

    Sequence, based on observed residues (ATOM records): (download) 
    >1sdzA (A:)
ndlnreetrlktftdwpldwldkrqlaqtgmyfthagdkvkcffcgveigsweqedqpvp
ehqrwspncpllrrrttnnvpinaealdrilppisyd