PDB entry 1sdx

View 1sdx on RCSB PDB site
Description: Crystal structure of the zinc saturated C-terminal half of bovine lactoferrin at 2.0 A resolution reveals two additional zinc binding sites
Class: transport protein
Keywords: Lactoferrin, C-lobe, TRANSPORT PROTEIN
Deposited on 2004-02-15, released 2004-03-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.192
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactotransferrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24627 (0-334)
      • see remark 999 (223)
      • see remark 999 (266)
    Domains in SCOPe 2.03: d1sdx.1
  • Chain 'E':
    Compound: lactotransferrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1sdx.1
  • Heterogens: ZN, CO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdxA (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdxE (E:)
    leaca