PDB entry 1sdw

View 1sdw on RCSB PDB site
Description: Reduced (Cu+) peptidylglycine alpha-hydroxylating monooxygenase with bound peptide and dioxygen
Class: oxidoreductase
Keywords: beta jelly-roll, OXIDOREDUCTASE
Deposited on 2004-02-14, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sdwa1, d1sdwa2
  • Heterogens: CU, NI, OXY, IYT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sdwA (A:)
    fsneclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkpras
    mdtvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvgget
    gskyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvn
    adiscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvd
    vtfgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdm
    frtipaeanipipv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdwA (A:)
    neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
    tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
    kyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnad
    iscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvt
    fgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfr
    tipaeanipipv