PDB entry 1sds

View 1sds on RCSB PDB site
Description: structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna
Deposited on 2004-02-13, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sdsa_
  • Chain 'B':
    Domains in SCOP 1.69: d1sdsb_
  • Chain 'C':
    Domains in SCOP 1.69: d1sdsc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sdsA (A:)
    mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
    lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdsA (A:)
    avyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahl
    pylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sdsB (B:)
    mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
    lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdsB (B:)
    fkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahlpylce
    ekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sdsC (C:)
    mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
    lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdsC (C:)
    vkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahlpyl
    ceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk