PDB entry 1sds

View 1sds on RCSB PDB site
Description: Structure of protein L7Ae bound to a K-turn derived from an archaeal box H/ACA sRNA
Class: protein/RNA complex
Keywords: Protein-RNA complex, protein-RNA complex COMPLEX
Deposited on 2004-02-13, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L7Ae
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: RPL7AE, MJ1203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sdsa_
  • Chain 'B':
    Compound: 50S ribosomal protein L7Ae
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: RPL7AE, MJ1203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sdsb_
  • Chain 'C':
    Compound: 50S ribosomal protein L7Ae
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: RPL7AE, MJ1203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sdsc_
  • Chain 'D':
    Compound: box H/ACA sRNA
  • Chain 'E':
    Compound: box H/ACA sRNA
  • Chain 'F':
    Compound: box H/ACA sRNA
  • Heterogens: CA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sdsA (A:)
    mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
    lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdsA (A:)
    avyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahl
    pylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sdsB (B:)
    mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
    lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdsB (B:)
    fkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahlpylce
    ekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sdsC (C:)
    mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
    lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdsC (C:)
    vkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahlpyl
    ceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.