PDB entry 1sdq

View 1sdq on RCSB PDB site
Description: Structure of reduced-NO adduct of mesopone cytochrome c peroxidase
Class: oxidoreductase
Keywords: Bifunctional catalyst, cytochrome c peroxidase, Trp191 cation radical, 4-mesoporphyrinone, proximal loop, OXIDOREDUCTASE
Deposited on 2004-02-13, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO, YKR066C, OBPYC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sdqa_
  • Heterogens: FMI, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sdqA (A:)
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl