PDB entry 1sdn

View 1sdn on RCSB PDB site
Description: crystal structure of a deacylation-defective mutant of penicillin-binding protein 5 modified by mercury
Class: hydrolase
Keywords: peptidoglycan synthesis, penicllin-binding protein, dd-carboxypeptidase, hydrolase
Deposited on 2004-02-13, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 5
    Species: Escherichia coli [TaxId:562]
    Gene: DACA, PFV, B0632, C0722, Z0777, ECS0670
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04287
      • engineered (104)
    Domains in SCOPe 2.07: d1sdna1, d1sdna2
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sdnA (A:)
    ddlniktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamka
    gkfketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirdinlqsgndacvamad
    faagsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpney
    siykekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavm
    ggrtfkgreaeskklltwgfrffetvnplkvgkefasepvwfgdsdraslgvdkdvylti
    prgrmkdlkasyvlnsselhaplqknqvvgtinfqldgktieqrplvvlqeipegnfgdp
    vid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdnA (A:)
    lniktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamkagk
    fketdlvtigndawatgsslmflkpgmqvpvsqlirdinlqsgndacvamadfaagsqda
    fvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpneysiykekef
    tfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavmggrtfkgr
    eaeskklltwgfrffetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdl
    kasyvlnsselhaplqknqvvgtinfqldgktieqrplvvlqeipeg