PDB entry 1sdm

View 1sdm on RCSB PDB site
Description: Crystal structure of kinesin-like calmodulin binding protein
Class: transport protein
Keywords: kinesin, minus-end directed, Ca2+/calmodulin regulated, TRANSPORT PROTEIN
Deposited on 2004-02-13, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin heavy chain-like protein
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sdma_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sdmA (A:)
    edmkgkirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnat
    qddvfedtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkk
    dsnkfsfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyee
    lktiiqrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagserv
    kksgsagnqlkeaqsinkslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlm
    fvnispaesnldethnsltyasrvrsivndpsknvsskevarlkklvsywkeqagrkgdd
    eeleeiqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdmA (A:)
    kirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnatqddvf
    edtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkkdsnkf
    sfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyeelktii
    qrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagservkkeaq
    sinkslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlmfvnispaesnldet
    hnsltyasrvrsivndpsknvsskevarlkklvsyweleeiqde