PDB entry 1sdj

View 1sdj on RCSB PDB site
Description: x-ray structure of ydde_ecoli northeast structural genomics consortium target et25.
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-02-13, released 2004-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yddE
    Species: Escherichia coli [TaxId:562]
    Gene: YDDE, B1464
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37757 (11-307)
      • cloning artifact (0-10)
      • modified residue (11)
      • modified residue (45)
      • modified residue (175)
      • modified residue (222)
      • modified residue (242)
      • modified residue (274)
      • cloning artifact (308-309)
    Domains in SCOPe 2.08: d1sdja1, d1sdja2, d1sdja3, d1sdja4
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdjA (A:)
    sgrenlyfqghmkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetaf
    llhsddsdvriryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiek
    hnddyrisleqgtpgfepplegetraaiinalhlteddilpglpiqvattghskvmiplk
    pevdidalspdlnaltaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnan
    gpmgawlvhhnvlphdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilf
    haewaielgs