PDB entry 1sdi

View 1sdi on RCSB PDB site
Description: 1.65 A structure of Escherichia coli ycfC gene product
Class: structural genomics, unknown function
Keywords: structural genomics, paracytosis, peripheral membrane protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2004-02-13, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.15
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ycfC
    Species: Escherichia coli [TaxId:562]
    Gene: YCFC, B1132
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25746 (1-212)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1sdia1, d1sdia2
  • Heterogens: ACY, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdiA (A:)
    gaknyyditlalagicqsarlvqqlahqghcdadalhvslnsiidmnpsstlavfggsea
    nlrvgletllgvlnassrqglnaeltrytlslmvlerklssakgaldtlgnringlqrql
    ehfdlqsetlmsamaaiyvdvisplgpriqvtgspavlqspqvqakvratllagiraavl
    whqvgggrlqlmfsrnrlttqakqilahltpel