PDB entry 1sdf

View 1sdf on RCSB PDB site
Description: solution structure of stromal cell-derived factor-1 (sdf-1), nmr, minimized average structure
Class: cytokine
Keywords: cytokine, chemokines, protein synthesis, stromal cell-derived factor-1/g-coupled receptors, solution structure
Deposited on 1997-11-15, released 1998-01-28
The last revision prior to the SCOP 1.75 freeze date was dated 1998-01-28, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stromal cell-derived factor-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1sdfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdfA (A:)
    kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
    ylekaln