PDB entry 1sdf

View 1sdf on RCSB PDB site
Description: solution structure of stromal cell-derived factor-1 (sdf-1), nmr, minimized average structure
Deposited on 1997-11-15, released 1998-01-28
The last revision prior to the SCOP 1.71 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1sdf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdf_ (-)
    kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
    ylekaln