PDB entry 1sdd

View 1sdd on RCSB PDB site
Description: Crystal Structure of Bovine Factor Vai
Class: blood clotting
Keywords: coagulation, copper-binding protein, cofactor, blood clotting
Deposited on 2004-02-13, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.252
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor V
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sdda1, d1sdda2
  • Chain 'B':
    Compound: Coagulation factor V
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sddb1, d1sddb2, d1sddb3, d1sddb4
  • Heterogens: NAG, NDG, CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sddA (A:)
    aklrqfyvaaqsirwnyrpesthlsskpfetsfkkivyreyeayfqkekpqsrtsgllgp
    tlyaevgdimkvhfknkahkplsihaqgikyskfsegasysdhtlpmekmddavapgqey
    tyewiisehsgpthddppclthiyysyvnlvedfnsgligpllickkgtltedgtqkmfe
    kqhvlmfavfdeskswnqtsslmytvngyvngtmpditvcahdhiswhligmssgpelfs
    ihfngqvleqnhhkisaitlvsatsttanmtvspegrwtiasliprhfqagmqayidikn
    cakktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sddA (A:)
    aklrqfyvaaqsirwntsfkkivyreyeayfqkekpqsrtsgllgptlyaevgdimkvhf
    knkahkplsihaqgikyskfsegasysdhtlpmekmddavapgqeytyewiisehsgpth
    ddppclthiyysyvnlvedfnsgligpllickkgtltedgtqkmfekqhvlmfavfdesk
    swnqtsslmytvngyvngtmpditvcahligmssgpelfsihfngqvleqnhhkisaitl
    vsatsttgrwtiasliprhfqagmqayi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sddB (B:)
    sntgnrkyyyiaaeeiswdyskfvqsddvdyvpedtvykkvvfrkyldstftkldpqgey
    eehlgilgpviraevddviqvrfknlasrpyslhahglsyekssegktyeddspewfked
    naiqpnktytyvwhattrsgpenpgsacrawayysavnpekdihsgligpllicrkgtld
    ketnmpvdmrefvllfmvfdekkswyydkkptrswrrassevknshefhaingmiynlpg
    lrmyeqewvrlhllnlggsrdihvvhfhgqtllengtqqhqlgvwpllpgsfktlemkas
    kpgwwlldtevgeiqragmqtpflivdreckmpmglstgliadsqiqasefwgywepkla
    rlnnggsynawiaeklstefnpepwiqvdmqkevlltgiqtqgakhylkpyyttefcvay
    sldrknwrifkgnstrnvmyfggnsdastikenqidppvvaryirisptgsynkpalrle
    lqgcevngcstplgmesgkienkqitassfkkswwgnywepflarlnaqgrvnawqakan
    nnnqwlqidllkikkitaivtqgckslssemyvksytihysdqgtdwkpyrekssmvdki
    fegnnnvrghvknffnppiisrfiriipktwnqsialrlelfgcdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sddB (B:)
    ntgnrkyyyiaaeeiswdyskfvpedtvykkvvfrkyldstftkldpqgeyeehlgilgp
    viraevddviqvrfknlasrpyslhahglsnaiqpnktytyvwhattrsgpenpgsacra
    wayysavnpekdihsgligpllicrkgtldketnmpvdmrefvllfmvfdekkswyydns
    hefhaingmiynlpglrmyeqewvrlhllnlggsrdihvvhfhgqtllengtqqhqlgvw
    pllpgsfktlemkaskpgwwlldtevgeiqragmqtpflivdreckmpmglstgliadsq
    iqasefwgywepklarlnnggsynawiaeklstefnpepwiqvdmqkevlltgiqtqgak
    hylkpyyttefcvaysldrknwrifkgnstrnvmyfggnsdastikenqidppvvaryir
    isptgsynkpalrlelqgcevngcstplgmesgkienkqitassfkkswwgnywepflar
    lnaqgrvnawqakannnnqwlqidllkikkitaivtqgckslssemyvksytihysdqgt
    dwkpyrekssmvdkifegnnnvrghvknffnppiisrfiriipktwnqsialrlelfgcd
    m