PDB entry 1sd5

View 1sd5 on RCSB PDB site
Description: Crystal structure of Rv1626
Class: structural genomics, unknown function
Keywords: rv1626, transcriptional, antiterminator, two components system, structural genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, UNKNOWN FUNCTION
Deposited on 2004-02-13, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative antiterminator
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: rv1626
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sd5a_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sd5A (A:)
    mtgpttdadaavprrvliaedealirmdlaemlreegyeivgeagdgqeavelaelhkpd
    lvimdvkmprrdgidaaseiaskriapivvltafsqrdlverardagamaylvkpfsisd
    lipaielavsrfreitalegevatlserletrklverakgllqtkhgmtepdafkwiqra
    amdrrttmkrvaevvletlgtpkdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sd5A (A:)
    prrvliaedealirmdlaemlreegyeivgeagdgqeavelaelhkpdlvimdvkmprrd
    gidaaseiaskriapivvltafsqrdlverardagamaylvkpfsisdlipaielavsrf
    reitalegevatlserletrklverakgllqtkhgmtepdafkwiqraamdrrttmkrva
    evvletlg