PDB entry 1sd4

View 1sd4 on RCSB PDB site
Description: Crystal Structure of a SeMet derivative of BlaI at 2.0 A
Class: DNA binding protein
Keywords: BlaI, MecI, repressor, methicillin, B-lactam, DNA binding protein
Deposited on 2004-02-13, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillinase repressor
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UB84 (Start-125)
      • modified residue (9)
      • modified residue (15)
      • modified residue (79)
      • modified residue (94)
    Domains in SCOPe 2.08: d1sd4a_
  • Chain 'B':
    Compound: Penicillinase repressor
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UB84 (Start-125)
      • modified residue (9)
      • modified residue (15)
      • modified residue (79)
      • modified residue (94)
    Domains in SCOPe 2.08: d1sd4b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sd4A (A:)
    mtnkqveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikr
    ykseniyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdil
    ndiskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sd4A (A:)
    qveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikrykse
    niyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdilndis
    kk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sd4B (B:)
    mtnkqveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikr
    ykseniyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdil
    ndiskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sd4B (B:)
    qveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikrykse
    niyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdilndis
    kk