PDB entry 1sd0

View 1sd0 on RCSB PDB site
Description: Structure of arginine kinase C271A mutant
Class: transferase
Keywords: essential, cysteine, bimolecular, phosphotransferase, transition state, chloride, phosphagen kinase
Deposited on 2004-02-12, released 2004-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Limulus polyphemus [TaxId:6850]
    Gene: AK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51541 (Start-356)
      • cloning artifact (102)
      • cloning artifact (111)
      • cloning artifact (115)
      • engineered (270)
      • cloning artifact (350)
    Domains in SCOPe 2.08: d1sd0a1, d1sd0a2
  • Heterogens: NO3, MG, CL, ARG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sd0A (A:)
    mvdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgven
    ldsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfi
    istrvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqq
    liddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlk
    tvykrlvtavdniesklpfshddrfgfltfaptnlgttmrasvhiqlpklakdrkvledi
    askfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemirmekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sd0A (A:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfaptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemirmekaaa