PDB entry 1scw

View 1scw on RCSB PDB site
Description: toward better antibiotics: crystal structure of r61 dd-peptidase inhibited by a novel monocyclic phosphate inhibitor
Class: hydrolase
Keywords: cyclic phosphate, antibiotic, peptidoglycan, penicillin binding protein, hydrolase
Deposited on 2004-02-12, released 2004-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: 0.105
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Streptomyces sp. [TaxId:31952]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1scwa_
  • Heterogens: CP5, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1scwA (A:)
    adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
    gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
    aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
    teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
    isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
    tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1scwA (A:)
    lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
    vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
    tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
    yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
    stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
    qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp