PDB entry 1scv

View 1scv on RCSB PDB site
Description: nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin I
Class: contractile protein, structural protein
Keywords: troponin c-troponin I interaction, cardiac, muscle protein, calcium binding protein, contractile protein, structural protein
Deposited on 2004-02-12, released 2004-11-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Gallus gallus [TaxId:9031]
    Gene: TNNC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1scva_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1scvA (A:)
mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
dknndgridydeflefmkgve