PDB entry 1scv

View 1scv on RCSB PDB site
Description: nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin I
Class: contractile protein, structural protein
Keywords: troponin c-troponin I interaction, cardiac, muscle protein, calcium binding protein
Deposited on 2004-02-12, released 2004-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: GALLUS GALLUS
    Gene: TNNC1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1scva_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1scvA (A:)
    mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
    dknndgridydeflefmkgve