PDB entry 1scr

View 1scr on RCSB PDB site
Description: high-resolution structures of single-metal-substituted concanavalin a: the co,ca-protein at 1.6 angstroms and the ni,ca-protein at 2.0 angstroms
Class: lectin(agglutinin)
Keywords: lectin(agglutinin)
Deposited on 1993-12-06, released 1994-05-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-10-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.159
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia ensiformis
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • conflict (150)
      • conflict (154)
    Domains in SCOP 1.75: d1scra_
  • Heterogens: NI, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1scrA (A:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan