PDB entry 1scq

View 1scq on RCSB PDB site
Description: K236L mutant of hydroxynitrile lyase from Hevea brasiliensis in complex with acetonecyanohydrin
Class: lyase
Keywords: alpha-beta hydrolase fold, substrate complex, catalytic triad, lyase
Deposited on 2004-02-12, released 2004-06-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (s)-acetone-cyanohydrin lyase
    Species: Hevea brasiliensis [TaxId:3981]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52704 (Start-256)
      • engineered (235)
    Domains in SCOPe 2.05: d1scqa_
  • Heterogens: SO4, CNH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1scqA (A:)
    mafahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysep
    lltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdk
    lmevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfq
    nilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhllqlt
    ktkeiaeilqevadtyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1scqA (A:)
    afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
    ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
    mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
    ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhllqltk
    tkeiaeilqevadtyn