PDB entry 1sco

View 1sco on RCSB PDB site
Description: scorpion toxin (osk1 toxin) with high affinity for small conductance ca(2+)-activated k+ channel in neuroblastoma-x-gluoma ng 108-15 hybrid cells, nmr, 30 structures
Class: potassium channel inhibitor
Keywords: potassium channel inhibitor
Deposited on 1996-04-01, released 1997-01-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: scorpion toxin osk1
  Species: Orthochirus scrobiculosus [TaxId:6892]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55896 (0-37)
  Domains in SCOPe 2.01: d1scoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1scoA (A:)
  gviinvkckisrqclepckkagmrfgkcmngkchctpk