PDB entry 1scm

View 1scm on RCSB PDB site
Description: structure of the regulatory domain of scallop myosin at 2.8 angstroms resolution
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1994-01-06, released 1994-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.201
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain
    Species: Argopecten irradians [TaxId:31199]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: myosin regulatory light chain
    Species: Argopecten irradians [TaxId:31199]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1scmb_
  • Chain 'C':
    Compound: myosin essential light chain
    Species: Argopecten irradians [TaxId:31199]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1scmc_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1scmB (B:)
    lpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftm
    flsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfke
    apveggkfdyvkftamikgsgeeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1scmB (B:)
    lpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftm
    flsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfke
    apveggkfdyvkftamik
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1scmC (C:)
    sqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeksl
    pfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedvd
    eiikltdlqedlegnvkyedfvkkvmagp