PDB entry 1sc8

View 1sc8 on RCSB PDB site
Description: Urokinase Plasminogen Activator B-Chain-J435 Complex
Class: hydrolase
Keywords: urokinase, inhibitor, serine protease, human, hydrolase
Deposited on 2004-02-12, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.24
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: Plasminogen activator, urokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: homo
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (Start-261)
      • engineered (135)
    Domains in SCOPe 2.07: d1sc8u_
  • Heterogens: SO4, 2IN, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1sc8U (U:)
    lkfqcgqktlrprfkiiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisat
    hcfidypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirs
    kegrcaqpsrtiqtislpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishr
    ecqqphyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalk
    dkpgvytrvshflpwirshtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc8U (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtke