PDB entry 1sc7

View 1sc7 on RCSB PDB site
Description: Human DNA Topoisomerase I (70 Kda) In Complex With The Indenoisoquinoline MJ-II-38 and Covalent Complex With A 22 Base Pair DNA Duplex
Class: isomerase/DNA
Keywords: complex (isomerase/DNA), DNA, topoisomerase I, drug, poison, idenoisoquinoline
Deposited on 2004-02-11, released 2005-04-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.233
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (Start-591)
      • modified residue (549)
    Domains in SCOPe 2.01: d1sc7a1, d1sc7a2, d1sc7a3
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*t)-3'
  • Chain 'C':
    Compound: 5'-d(*(tgp)p*gp*ap*ap*ap*ap*ap*tp*tp*tp*tp*t)-3'
  • Chain 'D':
    Compound: 5'-d(*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*cp*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3'
  • Heterogens: M38, PG4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sc7A (A:)
    kkpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyep
    lpenvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneekni
    itnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianf
    kieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwl
    vswteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvr
    qravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkd
    siryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyn
    asitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkida
    kkeqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkq
    ialgtsklnyldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc7A (A:)
    eeqkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevat
    ffakmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkq
    mskeeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrim
    pediiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikge
    kdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeeget
    adtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenk
    qpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakils
    ynranravailcnhqrappktfeksmmnlqtkidakkeqladarrdlksakadakvmkda
    ktkkvveskkkavqrleeqlmklevqatdreenkqialgtsklnyldpritvawckkwgv
    piekiynktqrekfawaidmadedyef
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.