PDB entry 1sc6

View 1sc6 on RCSB PDB site
Description: Crystal Structure of W139G D-3-Phosphoglycerate dehydrogenase complexed with NAD+
Class: oxidoreductase
Keywords: allosteric regulation phosphoglycerate dehydrogenase PGDH, OXIDOREDUCTASE
Deposited on 2004-02-11, released 2005-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: SERA, B2913, C3494, Z4251, ECS3784, SF2898, S3098
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (0-403)
      • engineered (74)
      • engineered (76)
      • engineered (132)
      • modified residue (168)
      • modified residue (196)
      • modified residue (213-214)
      • modified residue (222)
      • engineered (243)
      • engineered (275)
      • modified residue (334)
      • modified residue (369)
      • modified residue (390)
    Domains in SCOPe 2.06: d1sc6a1, d1sc6a2, d1sc6a3
  • Chain 'B':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: SERA, B2913, C3494, Z4251, ECS3784, SF2898, S3098
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (0-403)
      • engineered (74)
      • engineered (76)
      • engineered (132)
      • modified residue (168)
      • modified residue (196)
      • modified residue (213-214)
      • modified residue (222)
      • engineered (243)
      • engineered (275)
      • modified residue (334)
      • modified residue (369)
      • modified residue (390)
    Domains in SCOPe 2.06: d1sc6b1, d1sc6b2, d1sc6b3
  • Chain 'C':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: SERA, B2913, C3494, Z4251, ECS3784, SF2898, S3098
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (Start-403)
      • engineered (74)
      • engineered (76)
      • engineered (132)
      • modified residue (168)
      • modified residue (196)
      • modified residue (213-214)
      • modified residue (222)
      • engineered (243)
      • engineered (275)
      • modified residue (334)
      • modified residue (369)
      • modified residue (390)
    Domains in SCOPe 2.06: d1sc6c1, d1sc6c2, d1sc6c3
  • Chain 'D':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: SERA, B2913, C3494, Z4251, ECS3784, SF2898, S3098
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (0-403)
      • engineered (74)
      • engineered (76)
      • engineered (132)
      • modified residue (168)
      • modified residue (196)
      • modified residue (213-214)
      • modified residue (222)
      • engineered (243)
      • engineered (275)
      • modified residue (334)
      • modified residue (369)
      • modified residue (390)
    Domains in SCOPe 2.06: d1sc6d1, d1sc6d2, d1sc6d3
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sc6A (A:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvgnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienkl
    plgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdi
    paladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqenigl
    evagklikysdngstlsavnfpevslplhggrrlmhihenrpgvltalnkifaeqgvnia
    aqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc6A (A:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvgnsfeargkklgiigyghigtqlgilaeslgmyvyfydienklplgna
    tqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdipalad
    alaskhlagaaidvdpftsplaefdnvlltphiggstqeaqeniglevagklikysdngs
    tlsavnfpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvv
    idieadedvaekalqamkaipgtirarlly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sc6B (B:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvgnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienkl
    plgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdi
    paladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqenigl
    evagklikysdngstlsavnfpevslplhggrrlmhihenrpgvltalnkifaeqgvnia
    aqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc6B (B:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvgnsfeargkklgiigyghigtqlgilaeslgmyvyfydienklplgna
    tqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdipalad
    alaskhlagaaidsplaefdnvlltphiggstqeaqeniglevagklikysdngstlsav
    nfpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiea
    dedvaekalqamkaipgtirarlly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sc6C (C:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvgnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienkl
    plgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdi
    paladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqenigl
    evagklikysdngstlsavnfpevslplhggrrlmhihenrpgvltalnkifaeqgvnia
    aqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc6C (C:)
    dkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlted
    vinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrgvp
    eanakahrgvgngsfeargkklgiigyghigtqlgilaeslgmyvyfydienklplgnat
    qvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdipalada
    laskhlagaaidvsplaefdnvlltpeaqeniglevagklikysdngstlsavnfpevsl
    plhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidieadedvaek
    alqamkaipgtirarlly
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sc6D (D:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvgnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienkl
    plgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdi
    paladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqenigl
    evagklikysdngstlsavnfpevslplhggrrlmhihenrpgvltalnkifaeqgvnia
    aqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc6D (D:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvgsfeargkklgiigyghigtqlgilaeslgmyvyfydienklplgnat
    qvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdipalada
    laskhlagaaidvpftsplaefdnvlltpstqeaqeniglevagklikysdngstlsavn
    fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
    edvaekalqamkaipgtirarlly