PDB entry 1sc5

View 1sc5 on RCSB PDB site
Description:
Deposited on 2004-02-11, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 3.26 Å
R-factor: 0.241
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1sc5a1, d1sc5a2, d1sc5a3
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1sc5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sc5A (A:)
    gshmknpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnl
    stenpkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdee
    vakelgisteelfktldkinfsyilsleevfrdfardyselipsstnveeevikreltek
    vkeavsklpereklviqlifyeelpakevakiletsvsrvsqlkakalerlremlsnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc5A (A:)
    knpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlsten
    pkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdeevake
    lgisteelfktldkinfsyilsleevfrdfardyselipsstevikreltekvkeavskl
    pereklviqlifyeelpakevakiletsvsrvsqlkakalerlremls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sc5B (B:)
    mvnrielsrligllletekrknteqkesgtnkiedkvtlskiaqelskndveekdlekkv
    kelkekiekgeyevsdekvvkgliefft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc5B (B:)
    nrielsrligllletkiedkvtlskiaqelskndveekdlekkvkelkekiekgeyevsd
    ekvvkgliefft