PDB entry 1sc5

View 1sc5 on RCSB PDB site
Description: Sigma-28(FliA)/FlgM complex
Class: transcription
Keywords: RNA polymerase sigma factor, anti-sigma factor, transcription, flagellar gene regulation
Deposited on 2004-02-11, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.26 Å
R-factor: 0.241
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor FliA
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: FLIA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sc5a1, d1sc5a2, d1sc5a3
  • Chain 'B':
    Compound: anti-sigma factor FlgM
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: FLGM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sc5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sc5A (A:)
    gshmknpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnl
    stenpkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdee
    vakelgisteelfktldkinfsyilsleevfrdfardyselipsstnveeevikreltek
    vkeavsklpereklviqlifyeelpakevakiletsvsrvsqlkakalerlremlsnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc5A (A:)
    knpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlsten
    pkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdeevake
    lgisteelfktldkinfsyilsleevfrdfardyselipsstevikreltekvkeavskl
    pereklviqlifyeelpakevakiletsvsrvsqlkakalerlremls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sc5B (B:)
    mvnrielsrligllletekrknteqkesgtnkiedkvtlskiaqelskndveekdlekkv
    kelkekiekgeyevsdekvvkgliefft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc5B (B:)
    nrielsrligllletkiedkvtlskiaqelskndveekdlekkvkelkekiekgeyevsd
    ekvvkgliefft