PDB entry 1sc3

View 1sc3 on RCSB PDB site
Description: Crystal structure of the human caspase-1 C285A mutant in complex with malonate
Class: hydrolase
Keywords: malonate-bound caspase-1, hydrolase
Deposited on 2004-02-11, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-1 beta convertase
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29466 (Start-177)
      • engineered (165)
    Domains in SCOPe 2.07: d1sc3.1
  • Chain 'B':
    Compound: Interleukin-1 beta convertase
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sc3.1
  • Heterogens: MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sc3A (A:)
    npamptssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprr
    tgaevditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgi
    regicgkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqaargdspgvvwfkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc3A (A:)
    tssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaev
    ditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregic
    gkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqaargdspgvvwfkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sc3B (B:)
    aikkahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfs
    feqpdgraqmpttervtltrcfylfpgh