PDB entry 1sc0

View 1sc0 on RCSB PDB site
Description: X-ray Structure of YB61_HAEIN Northeast Structural Genomics Consortium Target IR63
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-02-11, released 2004-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1161
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (Start-137)
      • modified residue (39)
      • modified residue (46)
    Domains in SCOPe 2.06: d1sc0a_
  • Chain 'B':
    Compound: Hypothetical protein HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1161
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (Start-137)
      • modified residue (39)
      • modified residue (46)
    Domains in SCOPe 2.06: d1sc0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sc0A (A:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc0A (A:)
    lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval
    aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte
    enklccvsrltlsvinl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sc0B (B:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sc0B (B:)
    lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval
    aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte
    enklccvsrltlsvinl