PDB entry 1sbz

View 1sbz on RCSB PDB site
Description: crystal structure of dodecameric fmn-dependent ubix-like decarboxylase from escherichia coli o157:h7
Deposited on 2004-02-11, released 2004-10-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sbza_
  • Chain 'B':
    Domains in SCOP 1.71: d1sbzb_
  • Chain 'C':
    Domains in SCOP 1.71: d1sbzc_
  • Chain 'D':
    Domains in SCOP 1.71: d1sbzd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sbzA (A:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqglpqarnfsqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbzA (A:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehprw
    qgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sbzB (B:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqglpqarnfsqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbzB (B:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfgle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sbzC (C:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqglpqarnfsqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbzC (C:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfgle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sbzD (D:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqglpqarnfsqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sbzD (D:)
    mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf
    shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv
    premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya
    rrwqg