PDB entry 1sby

View 1sby on RCSB PDB site
Description: Alcohol dehydrogenase from Drosophila lebanonensis complexed with NAD+ and 2,2,2-trifluoroethanol at 1.1 A resolution
Class: oxidoreductase
Keywords: alcohol dehydrogenase, ternary complex, NAD, trifluoroethanol
Deposited on 2004-02-11, released 2005-02-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.132
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Drosophila lebanonensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sbya1
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Drosophila lebanonensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sbyb1
  • Heterogens: NAD, ETF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbyA (A:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbyB (B:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi