PDB entry 1sbx

View 1sbx on RCSB PDB site
Description: Crystal structure of the Dachshund-homology domain of human SKI
Class: oncoprotein
Keywords: winged helix, forkhead, ONCOPROTEIN
Deposited on 2004-02-11, released 2004-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.17
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ski oncogene
    Species: Homo sapiens [TaxId:9606]
    Gene: SKI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12755 (4-105)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (5)
      • modified residue (77)
    Domains in SCOPe 2.06: d1sbxa1, d1sbxa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbxA (A:)
    gshmfmpsdrstercetvlegetiscfvvggekrlclpqilnsvlrdfslqqinavcdel
    hiycsrctadqleilkvmgilpfsapscglitktdaerlcnallyg