PDB entry 1sbw

View 1sbw on RCSB PDB site
Description: crystal structure of mung bean inhibitor lysine active fragment complex with bovine beta-trypsin at 1.8a resolution
Class: hydrolase/hydrolase inhibitor
Keywords: complex(proteinase/inhibitor), hydrolase/hydrolase inhibitor complex
Deposited on 1999-04-29, released 1999-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (beta-trypsin)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sbwa_
  • Chain 'I':
    Compound: protein (mung bean inhibitor lysin active frament)
    Species: Vigna radiata [TaxId:157791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01062
      • conflict (9)
      • conflict (17)
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbwA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    No sequence available.