PDB entry 1sbw

View 1sbw on RCSB PDB site
Description: crystal structure of mung bean inhibitor lysine active fragment complex with bovine beta-trypsin at 1.8a resolution
Deposited on 1999-04-29, released 1999-05-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-07, with a file datestamp of 2000-04-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1sbwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sbwA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn