PDB entry 1sbs

View 1sbs on RCSB PDB site
Description:
Deposited on 1998-04-08, released 1999-04-13
The last revision prior to the SCOP 1.65 freeze date was dated 1999-04-13, with a file datestamp of 1999-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1sbsh1, d1sbsh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1sbsl1, d1sbsl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbsH (H:)
    evnleesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvadirlksnnyat
    lyaesvkgrftisrddskssvylqmnnlraedtgiyyctrgayyrydyamdywgqgtsvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbsL (L:)
    divmsqspsslavsvgekvtmtckssqsllyssnqmnylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissveaedlavyycqqyhsypftfgsgtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec