PDB entry 1sbs

View 1sbs on RCSB PDB site
Description: crystal structure of an anti-hcg fab
Class: monoclonal antibody
Keywords: monoclonal antibody, fab-fragment, reproduction
Deposited on 1998-04-08, released 1999-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal antibody 3a2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB34981 (0-221)
      • conflict (2)
      • conflict (19)
      • conflict (27)
      • conflict (30)
      • conflict (42)
      • conflict (47)
      • conflict (49)
      • conflict (52)
      • insertion (58)
      • conflict (60)
      • conflict (100-102)
      • insertion (104-106)
      • conflict (108-110)
      • conflict (117)
      • conflict (122)
      • conflict (196-197)
    Domains in SCOPe 2.07: d1sbsh1, d1sbsh2
  • Chain 'L':
    Compound: monoclonal antibody 3a2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB04554 (2-219)
      • conflict (4)
      • conflict (14)
      • conflict (21)
      • conflict (30-35)
      • conflict (84)
      • conflict (94)
      • insertion (96-97)
      • conflict (100)
      • conflict (105)
      • conflict (108)
    Domains in SCOPe 2.07: d1sbsl1, d1sbsl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbsH (H:)
    evnleesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvadirlksnnyat
    lyaesvkgrftisrddskssvylqmnnlraedtgiyyctrgayyrydyamdywgqgtsvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbsL (L:)
    divmsqspsslavsvgekvtmtckssqsllyssnqmnylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissveaedlavyycqqyhsypftfgsgtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec